PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G169100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 892aa    MW: 99245.6 Da    PI: 5.1829
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G169100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.5e-193884148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+W++eEd+++++ v+++G++ W+tIa+ ++ gR +kqc++rw+++l
  Brast08G169100.1.p 38 KGPWSKEEDDIIIEMVNEYGPKKWSTIAQALP-GRIGKQCRERWHNHL 84
                        79******************************.*************97 PP

2Myb_DNA-binding52.89.3e-1790132145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         r++WT+eE+ +l++a++ +G++ W+  ++ ++ gRt++ +k++w+
  Brast08G169100.1.p  90 RDAWTQEEEIRLIQAHQAYGNK-WAELSKFLP-GRTDNAIKNHWH 132
                         789*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500903.9151332IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.2E-121548IPR009057Homeodomain-like
PROSITE profilePS5129431.7973388IPR017930Myb domain
SuperFamilySSF466891.39E-3135131IPR009057Homeodomain-like
SMARTSM007172.9E-183786IPR001005SANT/Myb domain
CDDcd001676.84E-164084No hitNo description
PfamPF139211.8E-1841101No hitNo description
Gene3DG3DSA:1.10.10.601.7E-264991IPR009057Homeodomain-like
SMARTSM007172.4E-1589137IPR001005SANT/Myb domain
PROSITE profilePS5129419.52789139IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-2292138IPR009057Homeodomain-like
CDDcd001671.27E-1192132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 892 aa     Download sequence    Send to blast
MMLDNRQHFC LPAECFRDRT DVQCLHRWQK VLNPELVKGP WSKEEDDIII EMVNEYGPKK  60
WSTIAQALPG RIGKQCRERW HNHLNPGINR DAWTQEEEIR LIQAHQAYGN KWAELSKFLP  120
GRTDNAIKNH WHSSVKKKFE SYRAEGLLAQ LKGLPPVVYP TSLTVDSSSA MTQKNSEGSG  180
LNAILEVEDS SEFSQSSLAN VSCSQVEHVD AALGCHLQVN FCDERADDSY SLGQEACYTN  240
SNNVASALPE TRHQLSVSEN DLDKHLQEDY SEQMDLDVGE VPNSSVFTDS QASKELFQHT  300
QVISMLPTVS GYEHNTNTTS EAEFDNKKGL QSELWQDISF QGILSAPDSI SADSFLSPNC  360
QRGLYSLEAV KNFEESLYPV HTFNSSSLTS TAHLQSSATS MPQSFISSAS ASCTPGAKFE  420
TIGIPVSLES ITCQDVPTDV PIPESRKQQP TDVEQSSLEH TTMGREASPI HGETVVGQKK  480
HSEALCYEPP CFPSAEVPFV SCDLLSSSDL PEYSPLGIRE LMRSSMNFST PIRLWSSPTH  540
VRSPDAVLKS AAKSFICTPS IIKKRQRELS SPTPDIKFAK KIGTEKDCGN SGMSSIRTER  600
SFMDVIEDEL IDFISHQNEE NLKETTHQGI NEENSKRNTL EEGKRCSTMD KDTTCTHQGI  660
NEENSKRNTL EEGKRCSTMD KDTTCNLLST GILTESNANS LSPPKHVQNP RIQKLNTTAK  720
SLSKDIISSR SKPTNLIVEK SSPYIDADYQ YVNILADTPG IKRGLESPSA WKSPLFTNFQ  780
DGFFMSPAGR TFDALGLVKQ INEQNAPALE EAHEVLACGR AQNPCSEENS NKENVEHTII  840
REHVTSNQPS KVMAEARILD FNECTTPVKK KEECSIFERS PTSSYLLKNV R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C2e-571813838158MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-571813838158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231589.10.0PREDICTED: myb-related protein 3R-1 isoform X2
TrEMBLA0A0Q3R0P80.0A0A0Q3R0P8_BRADI; Uncharacterized protein
STRINGBRADI2G31887.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-80Homeodomain-like protein